ZNF134 Antibody

Images

 
Western Blot: ZNF134 Antibody [NBP2-86434] - WB Suggested Anti-ZNF134 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Immunohistochemistry: ZNF134 Antibody [NBP2-86434] - Human kidney

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF134 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF134. Peptide sequence: SEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF134
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for ZNF134 Antibody

  • MGC138499
  • MGC141970
  • pHZ-15
  • zinc finger protein 134 (clone pHZ-15)
  • zinc finger protein 134

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF134 Antibody (NBP2-86434) (0)

There are no publications for ZNF134 Antibody (NBP2-86434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF134 Antibody (NBP2-86434) (0)

There are no reviews for ZNF134 Antibody (NBP2-86434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF134 Antibody (NBP2-86434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF134 Products

Bioinformatics Tool for ZNF134 Antibody (NBP2-86434)

Discover related pathways, diseases and genes to ZNF134 Antibody (NBP2-86434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF134

There are no specific blogs for ZNF134, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF134 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF134