ZMAT1 Antibody

Images

 
Western Blot: ZMAT1 Antibody [NBP2-83815] - WB Suggested Anti-ZMAT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZMAT1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZMAT1. Peptide sequence: EASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (92%), Porcine (93%), Bovine (92%), Rabbit (92%), Canine (93%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZMAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZMAT1 Antibody

  • KIAA1789
  • zinc finger, matrin type 1
  • zinc finger, matrin-type 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZMAT1 Antibody (NBP2-83815) (0)

There are no publications for ZMAT1 Antibody (NBP2-83815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMAT1 Antibody (NBP2-83815) (0)

There are no reviews for ZMAT1 Antibody (NBP2-83815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMAT1 Antibody (NBP2-83815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZMAT1 Products

Array NBP2-83815

Bioinformatics Tool for ZMAT1 Antibody (NBP2-83815)

Discover related pathways, diseases and genes to ZMAT1 Antibody (NBP2-83815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZMAT1

There are no specific blogs for ZMAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZMAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMAT1