Zinc finger protein 772 Antibody

Images

 
Western Blot: Zinc finger protein 772 Antibody [H00400720-B01P] - Analysis of ZNF772 expression in rat brain.
Western Blot: Zinc finger protein 772 Antibody [H00400720-B01P] - Analysis of ZNF772 expression in human kidney.
Western Blot: Zinc finger protein 772 Antibody [H00400720-B01P] - Analysis of ZNF772 expression in transfected 293T cell line by ZNF772 polyclonal antibody. Lane 1: ZNF772 transfected lysate(53.79 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Zinc finger protein 772 Antibody Summary

Immunogen
ZNF772 (AAI60024.1, 1 a.a. - 489 a.a.) full-length human protein. MAAAEPMGPAQVPMNSEVIVDPIQGQVNFEDVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLVMGSEPWVPDWVDMTLAVATETPGGSDPGCWHGMEDEEIPFEQSFSIGMSQIRIPKGGPSTQKAYPCGTCGLVLKDILHLAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSECGKTFSRKDSLVQHQRVHTGERPYECGECGKTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKAYSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQSSDLIAHQRVHNGEKPYVCSECGKAFSHKHVLVQHHRIHTGERPYKCSECGKAFRQRASLIRHWKIHTGERP
Specificity
This product is specific for Human ZNF772 purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 400720].
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZNF772
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Mouse polyclonal antibody raised against a full-length human ZNF772 protein.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Zinc finger protein 772 Antibody

  • DKFZp686I1569
  • zinc finger protein 772

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Zinc finger protein 772 Antibody (H00400720-B01P) (0)

There are no publications for Zinc finger protein 772 Antibody (H00400720-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zinc finger protein 772 Antibody (H00400720-B01P) (0)

There are no reviews for Zinc finger protein 772 Antibody (H00400720-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zinc finger protein 772 Antibody (H00400720-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zinc finger protein 772 Products

Bioinformatics Tool for Zinc finger protein 772 Antibody (H00400720-B01P)

Discover related pathways, diseases and genes to Zinc finger protein 772 Antibody (H00400720-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Zinc finger protein 772

There are no specific blogs for Zinc finger protein 772, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zinc finger protein 772 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF772
Uniprot