Zinc finger protein 180 Antibody (4F3)

Images

 
Western Blot: Zinc finger protein 180 Antibody (4F3) [H00007733-M01] - Analysis of ZNF180 expression in transfected 293T cell line by ZNF180 monoclonal antibody (M01), clone 4F3.Lane 1: ZNF180 transfected lysate(79.3 ...read more
Sandwich ELISA: Zinc finger protein 180 Antibody (4F3) [H00007733-M01] - Detection limit for recombinant GST tagged ZNF180 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Zinc finger protein 180 Antibody (4F3) Summary

Immunogen
ZNF180 (NP_037388.1 176 a.a. - 285 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDRIQSFCHG
Specificity
ZNF180 - zinc finger protein 180 (HHZ168) (4F3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF180
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Zinc finger protein 180 Antibody (4F3)

  • HHZ168zinc finger protein 180 (HHZ168)
  • zinc finger protein 180

Background

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See MIM 604749 for additional information on zinc finger proteins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92618
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007733-M01
Species: Hu
Applications: WB, ELISA

Publications for Zinc finger protein 180 Antibody (H00007733-M01) (0)

There are no publications for Zinc finger protein 180 Antibody (H00007733-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zinc finger protein 180 Antibody (H00007733-M01) (0)

There are no reviews for Zinc finger protein 180 Antibody (H00007733-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zinc finger protein 180 Antibody (H00007733-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zinc finger protein 180 Products

Bioinformatics Tool for Zinc finger protein 180 Antibody (H00007733-M01)

Discover related pathways, diseases and genes to Zinc finger protein 180 Antibody (H00007733-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zinc finger protein 180 Antibody (H00007733-M01)

Discover more about diseases related to Zinc finger protein 180 Antibody (H00007733-M01).
 

Pathways for Zinc finger protein 180 Antibody (H00007733-M01)

View related products by pathway.

Blogs on Zinc finger protein 180

There are no specific blogs for Zinc finger protein 180, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zinc finger protein 180 Antibody (4F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF180
Entrez
Uniprot