ZCPW1 Antibody - BSA Free

Images

 
Western Blot: ZCPW1 Antibody [NBP2-84343] - Host: Rabbit. Target Name: ZCWPW1. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlZCWPW1 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Product Discontinued
View other related ZCPW1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-84343
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZCPW1 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZCPW1. Peptide sequence: KATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZCWPW1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ZCPW1 Antibody - BSA Free

  • DKFZp434N0510
  • FLJ10057
  • ZCW1
  • zinc finger CW-type PWWP domain protein 1
  • zinc finger, CW type with PWWP domain 1
  • zinc finger, CW-type with PWWP domain 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP3-15243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ZCPW1 Antibody (NBP2-84343) (0)

There are no publications for ZCPW1 Antibody (NBP2-84343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCPW1 Antibody (NBP2-84343) (0)

There are no reviews for ZCPW1 Antibody (NBP2-84343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZCPW1 Antibody (NBP2-84343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZCPW1 Products

Array NBP2-84343

Research Areas for ZCPW1 Antibody (NBP2-84343)

Find related products by research area.

Blogs on ZCPW1

There are no specific blogs for ZCPW1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZCPW1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCWPW1