WDR45L Antibody


Western Blot: WDR45L Antibody [NBP2-84333] - WB Suggested Anti-WDR45L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: OVCAR-3 cell lysateWDR45B is supported by BioGPS gene expression data to be ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

WDR45L Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human WDR45L. Peptide sequence: HGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICA The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for WDR45L Antibody

  • WDR45-like protein
  • WDR45-like
  • WIPI3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR45L Antibody (NBP2-84333) (0)

There are no publications for WDR45L Antibody (NBP2-84333).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR45L Antibody (NBP2-84333) (0)

There are no reviews for WDR45L Antibody (NBP2-84333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR45L Antibody (NBP2-84333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WDR45L Products

Bioinformatics Tool for WDR45L Antibody (NBP2-84333)

Discover related pathways, diseases and genes to WDR45L Antibody (NBP2-84333). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDR45L

There are no specific blogs for WDR45L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WDR45L Antibody and receive a gift card or discount.


Gene Symbol WDR45L