WDCP Antibody


Western Blot: WDCP Antibody [NBP2-88587] - Host: Rabbit. Target Name: C2orf44. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/mlC2orf44 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

WDCP Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDCP. Peptide sequence: PPRLPQRKNLQSEKETYQLSKEVEILSRNLVEMQRCLSELTNRLHNGKKS The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for WDCP Antibody

  • C2orf44
  • chromosome 2 open reading frame 44
  • FLJ21945
  • PP384


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDCP Antibody (NBP2-88587) (0)

There are no publications for WDCP Antibody (NBP2-88587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDCP Antibody (NBP2-88587) (0)

There are no reviews for WDCP Antibody (NBP2-88587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDCP Antibody (NBP2-88587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WDCP Products

Bioinformatics Tool for WDCP Antibody (NBP2-88587)

Discover related pathways, diseases and genes to WDCP Antibody (NBP2-88587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDCP

There are no specific blogs for WDCP, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WDCP Antibody and receive a gift card or discount.


Gene Symbol WDCP