TTC24 Antibody


Western Blot: TTC24 Antibody [NBP2-83720] - Host: Rabbit. Target Name: TTC24. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TTC24 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TTC24. Peptide sequence: HRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLPGTVNHSHH The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for TTC24 Antibody

  • FLJ20249
  • tetratricopeptide repeat domain 24
  • tetratricopeptide repeat protein 24


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC24 Antibody (NBP2-83720) (0)

There are no publications for TTC24 Antibody (NBP2-83720).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC24 Antibody (NBP2-83720) (0)

There are no reviews for TTC24 Antibody (NBP2-83720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC24 Antibody (NBP2-83720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TTC24 Products

Bioinformatics Tool for TTC24 Antibody (NBP2-83720)

Discover related pathways, diseases and genes to TTC24 Antibody (NBP2-83720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC24

There are no specific blogs for TTC24, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTC24 Antibody and receive a gift card or discount.


Gene Symbol TTC24