TMPRSS11B Antibody

Images

 
Western Blot: TMPRSS11B Antibody [NBP2-86867] - Host: Rabbit. Target Name: TMPRSS11B. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMPRSS11B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMPRSS11B. Peptide sequence: DNCENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TMPRSS11B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMPRSS11B Antibody

  • Airway trypsin-like protease 5
  • DKFZp686L1818
  • EC 3.4.21.-
  • HATL5
  • transmembrane protease serine 11B
  • transmembrane protease, serine 11B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMPRSS11B Antibody (NBP2-86867) (0)

There are no publications for TMPRSS11B Antibody (NBP2-86867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMPRSS11B Antibody (NBP2-86867) (0)

There are no reviews for TMPRSS11B Antibody (NBP2-86867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS11B Antibody (NBP2-86867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMPRSS11B Products

Bioinformatics Tool for TMPRSS11B Antibody (NBP2-86867)

Discover related pathways, diseases and genes to TMPRSS11B Antibody (NBP2-86867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMPRSS11B

There are no specific blogs for TMPRSS11B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMPRSS11B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS11B