TBCK Antibody

Western Blot: TBCK Antibody [NBP1-56343] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TBCK Antibody Summary

• Immunogen: Synthetic peptides corresponding to MGC16169 The peptide sequence was selected from the middle region of MGC16169. Peptide sequence PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBCK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against MGC16169 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TBCK Antibody

• HSPC302
• MGC16169
• TBC domain-containing protein kinase-like protein
• TBC1 domain containing kinase
• TBCKL

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBCK
• Uniprot:
  • Q8TEA7-3(Human)