Recombinant Human TAS2R7 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TAS2R7 Protein [H00050837-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related TAS2R7 Peptides and Proteins

Order Details


    • Catalog Number
      H00050837-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TAS2R7 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-318 of Human TAS2R7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TAS2R7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
62.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAS2R7 GST (N-Term) Protein

  • MGC142121
  • T2R7taste receptor type 2 member 7
  • Taste receptor family B member 4
  • taste receptor, type 2, member 7
  • TRB4taste receptor, family B, member 4

Background

This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62664
Species: Hu
Applications: IHC,  IHC-P
NBP3-10050
Species: Hu
Applications: WB
AF640
Species: Mu
Applications: IHC, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for TAS2R7 Recombinant Protein (H00050837-P01) (0)

There are no publications for TAS2R7 Recombinant Protein (H00050837-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS2R7 Recombinant Protein (H00050837-P01) (0)

There are no reviews for TAS2R7 Recombinant Protein (H00050837-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAS2R7 Recombinant Protein (H00050837-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAS2R7 Products

Array H00050837-P01

Research Areas for TAS2R7 Recombinant Protein (H00050837-P01)

Find related products by research area.

Blogs on TAS2R7

There are no specific blogs for TAS2R7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAS2R7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAS2R7