TAS2R39 Antibody

Immunohistochemistry-Paraffin: TAS2R39 Antibody [NBP2-32560] - Staining of human kidney shows moderate cytoplasmic positivity in subsets of tubules.

Product Discontinued

TAS2R39 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAS2R39
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TAS2R39 Antibody

• T2R39
• T2R57
• taste receptor type 2 member 39
• Taste receptor type 2 member 57
• taste receptor, type 2, member 39

Background

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role insensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alphagustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAS2R39