SFT2D1 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

SFT2D1 Recombinant Protein Summary

Description
SFT2D1 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS
Preparation
Method
in vitro wheat germ expression system
Gene
SFT2D1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SFT2D1 Recombinant Protein

  • C6orf83
  • MGC19825
  • pRGR1chromosome 6 open reading frame 83
  • SFT2 domain containing 1
  • SFT2 domain-containing protein 1
  • vesicle transport protein SFT2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for SFT2D1 Recombinant Protein (H00113402-P01) (0)

There are no publications for SFT2D1 Recombinant Protein (H00113402-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFT2D1 Recombinant Protein (H00113402-P01) (0)

There are no reviews for SFT2D1 Recombinant Protein (H00113402-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFT2D1 Recombinant Protein (H00113402-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFT2D1 Recombinant Protein Products

SFT2D1 H00113402-P01

Related Products by Gene

Bioinformatics Tool for SFT2D1 Recombinant Protein (H00113402-P01)

Discover related pathways, diseases and genes to SFT2D1 Recombinant Protein (H00113402-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFT2D1

There are no specific blogs for SFT2D1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SFT2D1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00113402-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

SFT2D1 Antibody
NBP1-86737
SFT2D1 Antibody
NBP1-86737