SELT Recombinant Protein Antigen

Images

 
There are currently no images for SELT Protein (NBP1-90979PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SELT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SELT.

Source: E.coli

Amino Acid Sequence: CMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SELT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90979.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SELT Recombinant Protein Antigen

  • selenoprotein T
  • SelT

Background

The SELT gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop st

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
AF3798
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-10861
Species: Hu
Applications: WB
NBP2-20619
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6747
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP3-03548
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-91629
Species: Hu
Applications: WB
NBP1-92287
Species: Hu
Applications: IHC, IHC-P, WB
H00022928-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP3-16718
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24513
Species: Bv, Ca, Eq, Hu, Mu, Ma-Op, Pm, RM
Applications: IHC, IHC-P, WB
NBP2-10861
Species: Hu
Applications: WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86120
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14637
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5457
Species: Hu, Mu, Rt
Applications: WB

Publications for SELT Protein (NBP1-90979PEP) (0)

There are no publications for SELT Protein (NBP1-90979PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SELT Protein (NBP1-90979PEP) (0)

There are no reviews for SELT Protein (NBP1-90979PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SELT Protein (NBP1-90979PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SELT Products

Array NBP1-90979PEP

Bioinformatics Tool for SELT Protein (NBP1-90979PEP)

Discover related pathways, diseases and genes to SELT Protein (NBP1-90979PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELT Protein (NBP1-90979PEP)

Discover more about diseases related to SELT Protein (NBP1-90979PEP).
 

Pathways for SELT Protein (NBP1-90979PEP)

View related products by pathway.

PTMs for SELT Protein (NBP1-90979PEP)

Learn more about PTMs related to SELT Protein (NBP1-90979PEP).

Blogs on SELT

There are no specific blogs for SELT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SELT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SELT