SEL1L2 Antibody

Images

 
Western Blot: SEL1L2 Antibody [NBP2-83512] - Host: Rabbit. Target Name: SEL1L2. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEL1L2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEL1L2. Peptide sequence: GDQLFKMGIKVLQQSKSQKQKEEAYLLFAKAADMGNLKAMEKMADALLFG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SEL1L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEL1L2 Antibody

  • C20orf50
  • Chromosome 20 Open Reading Frame 50
  • Protein Sel-1 Homolog 2
  • Sel-1 Suppressor Of Lin-12-Like 2 (C. Elegans)
  • Sel-1L2
  • Suppressor Of Lin-12-Like Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEL1L2 Antibody (NBP2-83512) (0)

There are no publications for SEL1L2 Antibody (NBP2-83512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEL1L2 Antibody (NBP2-83512) (0)

There are no reviews for SEL1L2 Antibody (NBP2-83512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEL1L2 Antibody (NBP2-83512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEL1L2 Products

Bioinformatics Tool for SEL1L2 Antibody (NBP2-83512)

Discover related pathways, diseases and genes to SEL1L2 Antibody (NBP2-83512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SEL1L2

There are no specific blogs for SEL1L2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEL1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEL1L2