SCML4 Antibody

Images

 
Western Blot: SCML4 Antibody [NBP2-88220] - WB Suggested Anti-SCML4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: OVCAR-3 cell lysate

Product Details

Summary
Reactivity Hu, Po, Bv, CaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCML4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SCML4. Peptide sequence: EPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEH The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (93%), Bovine (93%), Canine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SCML4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCML4 Antibody

  • dJ47M23.1
  • FLJ36252
  • sex comb on midleg-like 4 (Drosophila)
  • sex comb on midleg-like protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SCML4 Antibody (NBP2-88220) (0)

There are no publications for SCML4 Antibody (NBP2-88220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCML4 Antibody (NBP2-88220) (0)

There are no reviews for SCML4 Antibody (NBP2-88220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCML4 Antibody (NBP2-88220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCML4 Products

Bioinformatics Tool for SCML4 Antibody (NBP2-88220)

Discover related pathways, diseases and genes to SCML4 Antibody (NBP2-88220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SCML4

There are no specific blogs for SCML4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCML4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCML4