RBM20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RBM20 Antibody [NBP1-91002] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & the Golgi apparatus.
Immunohistochemistry-Paraffin: RBM20 Antibody [NBP1-91002] - Staining of human kidney shows strong cytoplasmic and membranous positivity in glomerular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRAKEDQALLSVRPLQAHELNDFHGVAPLHLPHICSICDKKVFDLKDWELHVKGKLHAQKCLVFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM20 Protein (NBP1-91002PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM20 Antibody

  • RNA binding motif protein 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5540
Species: Mu
Applications: WB
NBP1-91002
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RBM20 Antibody (NBP1-91002) (0)

There are no publications for RBM20 Antibody (NBP1-91002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM20 Antibody (NBP1-91002) (0)

There are no reviews for RBM20 Antibody (NBP1-91002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBM20 Antibody (NBP1-91002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM20 Products

RBM20 NBP1-91002

Bioinformatics Tool for RBM20 Antibody (NBP1-91002)

Discover related pathways, diseases and genes to RBM20 Antibody (NBP1-91002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM20 Antibody (NBP1-91002)

Discover more about diseases related to RBM20 Antibody (NBP1-91002).
 

Pathways for RBM20 Antibody (NBP1-91002)

View related products by pathway.

Blogs on RBM20

There are no specific blogs for RBM20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM20