RBM20 Antibody

Western Blot: RBM20 Antibody [NBP1-91002] - Analysis in human heart tissue.

Immunocytochemistry/Immunofluorescence: RBM20 Antibody [NBP1-91002] - Staining of human cell line RH-30 shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RBM20 Antibody [NBP1-91002] - Staining of human kidney shows strong cytoplasmic and membranous positivity in glomerular cells.

Product Discontinued

RBM20 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRAKEDQALLSVRPLQAHELNDFHGVAPLHLPHICSICDKKVFDLKDWELHVKGKLHAQKCLVFS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM20
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Use in IHC-Fr reported in scientific literature (PMID:34201072) For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM20 Antibody

• RNA binding motif protein 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM20 Antibody (NBP1-91002)(3)

Publications using NBP1-91002

• Gaertner A, Bloebaum J, Brodehl A et al. The Combined Human Genotype of Truncating TTN and RBM20 Mutations Is Associated with Severe and Early Onset of Dilated Cardiomyopathy Genes 2021-06-08 [PMID: 34201072] (IHC-Fr, Human)
• Schneider JW, Oommen S, Qureshi MY et al. Dysregulated ribonucleoprotein granules promote cardiomyopathy in RBM20 gene-edited pigs Nat Med 2020-11-01 [PMID: 33188278]
• Gaertner A, Klauke B, Felski E et al. Cardiomyopathy associated mutations in the RS domain affect nuclear localization of RBM20 Hum. Mutat. 2020-08-25 [PMID: 32840935] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: RBM20