RBM20 Antibody


Immunocytochemistry/ Immunofluorescence: RBM20 Antibody [NBP1-91002] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RBM20 Antibody [NBP1-91002] - Staining of human kidney shows strong cytoplasmic and membranous positivity in glomerular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RBM20 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RRAKEDQALLSVRPLQAHELNDFHGVAPLHLPHICSICDKKVFDLKDWELHVKGKLHAQKCLVFS
Specificity of human RBM20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RBM20 Antibody

  • RNA binding motif protein 20


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RBM20 Antibody (NBP1-91002) (0)

There are no publications for RBM20 Antibody (NBP1-91002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM20 Antibody (NBP1-91002) (0)

There are no reviews for RBM20 Antibody (NBP1-91002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBM20 Antibody (NBP1-91002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RBM20 Products

Array NBP1-91002

Bioinformatics Tool for RBM20 Antibody (NBP1-91002)

Discover related pathways, diseases and genes to RBM20 Antibody (NBP1-91002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM20 Antibody (NBP1-91002)

Discover more about diseases related to RBM20 Antibody (NBP1-91002).

Pathways for RBM20 Antibody (NBP1-91002)

View related products by pathway.

Blogs on RBM20

There are no specific blogs for RBM20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBM20 Antibody and receive a gift card or discount.


Gene Symbol RBM20