RASAL3 Antibody - BSA Free

Western Blot: RASAL3 Antibody [NBP2-83439] - Host: Rabbit. Target Name: RASAL3. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p 6).(J) OCRs changes of cardiomyocytes with or without adenovirus knockdown of Rasal3 in ALKBH5flox/flox and ALKBH5flox/flox, alpha −MyHC-Cre mice.(K) Statistical analysis of basal respiration with or without adenovirus knockdown of Rasal3 in ALKBH5flox/flox and ALKBH5flox/flox, alpha −MyHC-Cre mice (n > 6). Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RASAL3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human RASAL3. Peptide sequence: PRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVAALREEQKVLSR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASAL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RASAL3 Antibody - BSA Free

• RAS Protein Activator Like 3
• RAS Protein Activator Like-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RASAL3 Antibody (NBP2-83439)(1)

Publication using NBP2-83439

• Gao R, Yang K, Qu Y et al. m6A demethylase ALKBH5 attenuates doxorubicin-induced cardiotoxicity via posttranscriptional stabilization of Rasal3 iScience 2023-03-01 [PMID: 36876119] (IHC, Mouse)

Bioinformatics

• Gene Symbol: RASAL3