| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, Mycoplasma |
| Clone | 6F10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse POMK/SGK196 Antibody (6F10) - Azide and BSA Free (H00084197-M03) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-POMK/SGK196 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | FLJ23356 (NP_115613, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML |
| Specificity | FLJ23356 - hypothetical protein FLJ23356 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | POMK |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24556084) |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publications using H00084197-M03 | Applications | Species |
|---|---|---|
| Walimbe AS, Okuma H, Joseph S et al. POMK regulates dystroglycan function via LARGE1-mediated elongation of matriglycan eLife 2020-09-25 [PMID: 32975514] (Western Blot, Immunohistochemistry-Frozen, Immunocytochemistry/ Immunofluorescence, Human) | Western Blot, Immunohistochemistry-Frozen, Immunocytochemistry/ Immunofluorescence | Human |
| von Renesse A, Petkova MV, Lutzkendorf S et al. POMK mutation in a family with congenital muscular dystrophy with merosin deficiency, hypomyelination, mild hearing deficit and intellectual disability. J. Med. Genet. 2014-02-21 [PMID: 24556084] (IHC-Fr, WB, ICC/IF, Human) | IHC-Fr, WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for POMK/SGK196 Antibody (H00084197-M03)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.