Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC, IHC-Fr, KD |
Clone | 6F10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | FLJ23356 (NP_115613, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML |
Specificity | FLJ23356 - hypothetical protein FLJ23356 |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | POMK |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24556084) |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00084197-M03 | Applications | Species |
---|---|---|
von Renesse A, Petkova MV, Lutzkendorf S et al. POMK mutation in a family with congenital muscular dystrophy with merosin deficiency, hypomyelination, mild hearing deficit and intellectual disability. J. Med. Genet. 2014-02-21 [PMID: 24556084] (IHC-Fr, WB, ICC/IF, Human) | IHC-Fr, WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for POMK/SGK196 Antibody (H00084197-M03)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.