We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Polypeptide GalNac Transferase 10/GALNT10 Recombinant Protein Antigen

Images

 
There are currently no images for Polypeptide GalNac Transferase 10/GALNT10 Protein (NBP1-85069PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Polypeptide GalNac Transferase 10/GALNT10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT10.

Source: E. coli

Amino Acid Sequence: AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GALNT10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85069.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Polypeptide GalNac Transferase 10/GALNT10 Recombinant Protein Antigen

  • DKFZp586H0623
  • EC 2.4.1.41
  • FLJ00205
  • FLJ11715
  • GalNAc transferase 10
  • GALNACT10
  • GalNAc-T10
  • GALNT10
  • Polypeptide GalNAc transferase 10
  • polypeptide N-acetylgalactosaminyltransferase 10
  • PPGALNACT10
  • pp-GaNTase 10
  • PPGANTASE10
  • Protein-UDP acetylgalactosaminyltransferase 10
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 10 (GalNAc-T10)

Background

The GALNT10 gene codes for a member of the GalNAc polypeptide N-acetylgalactosaminyltransferases. The enzyme catalyzes the initial reaction in O-linked (mucin-type) oligosaccharide biosynthesis. It creates four isoforms: isoform 1: 603 AA long, nearly 69 kDA; isoform 2: 541 AA long; nearly 62 kDA; isoform 3: 366 AA long; 41 kDA; and isoform 4: 276 AA long: approximately 31 kDA. The GALNT10 gene has been studied with its contribution to thyroiditis. It interacts with genes MUC7, MUC1, GALNT1, GALNT12, and PTCH1 in the metabolism of proteins, mucin type O-glycan biosynthesis, and in post-translational protein modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

9077-GT
Species: Hu
Applications: EnzAct
NBP1-85069PEP
Species: Hu
Applications: AC

Publications for Polypeptide GalNac Transferase 10/GALNT10 Protein (NBP1-85069PEP) (0)

There are no publications for Polypeptide GalNac Transferase 10/GALNT10 Protein (NBP1-85069PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 10/GALNT10 Protein (NBP1-85069PEP) (0)

There are no reviews for Polypeptide GalNac Transferase 10/GALNT10 Protein (NBP1-85069PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Polypeptide GalNac Transferase 10/GALNT10 Protein (NBP1-85069PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Polypeptide GalNac Transferase 10/GALNT10 Products

Blogs on Polypeptide GalNac Transferase 10/GALNT10

There are no specific blogs for Polypeptide GalNac Transferase 10/GALNT10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Polypeptide GalNac Transferase 10/GALNT10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT10