PCGF3 Antibody

Western Blot: PCGF3 Antibody [NBP2-88020] - Host: Rabbit. Target Name: PCGF3. Sample Type: Fetal Muscle lysates. Antibody Dilution: 1.0ug/ml

Western Blot: PCGF3 Antibody [NBP2-88020] - WB Suggested Anti-PCGF3 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:12500. Positive Control: Raji cell lysatePCGF3 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

• Reactivity: Hu, Po, Bv, Ca, Eq
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PCGF3 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCGF3. Peptide sequence: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Porcine (100%), Canine (93%), Equine (100%), Bovine (93%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCGF3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PCGF3 Antibody

• DKFZp686D20235
• DONG1
• FLJ36550
• FLJ43813
• MGC129615
• MGC40413
• polycomb group ring finger 3
• polycomb group RING finger protein 3
• ring finger protein 3
• RNF3
• RNF3ARING finger protein 3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCGF3