PCGF3 Antibody

Images

 
Western Blot: PCGF3 Antibody [NBP2-88020] - Host: Rabbit. Target Name: PCGF3. Sample Type: Fetal Muscle lysates. Antibody Dilution: 1.0ug/ml
Western Blot: PCGF3 Antibody [NBP2-88020] - WB Suggested Anti-PCGF3 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:12500. Positive Control: Raji cell lysatePCGF3 is strongly supported by BioGPS gene expression data to ...read more

Product Details

Summary
Reactivity Hu, Po, Bv, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCGF3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCGF3. Peptide sequence: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (100%), Canine (93%), Equine (100%), Bovine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
PCGF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCGF3 Antibody

  • DKFZp686D20235
  • DONG1
  • FLJ36550
  • FLJ43813
  • MGC129615
  • MGC40413
  • polycomb group ring finger 3
  • polycomb group RING finger protein 3
  • ring finger protein 3
  • RNF3
  • RNF3ARING finger protein 3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCGF3 Antibody (NBP2-88020) (0)

There are no publications for PCGF3 Antibody (NBP2-88020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCGF3 Antibody (NBP2-88020) (0)

There are no reviews for PCGF3 Antibody (NBP2-88020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCGF3 Antibody (NBP2-88020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PCGF3 Products

Bioinformatics Tool for PCGF3 Antibody (NBP2-88020)

Discover related pathways, diseases and genes to PCGF3 Antibody (NBP2-88020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for PCGF3 Antibody (NBP2-88020)

Find related products by research area.

Blogs on PCGF3

There are no specific blogs for PCGF3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCGF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCGF3