PARP8 Antibody


Western Blot: PARP8 Antibody [NBP2-13733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PARP8 Antibody [NBP2-13733] - Staining of human cell line HEK 293 shows positivity in nucleus & cytoplasm.
Immunohistochemistry-Paraffin: PARP8 Antibody [NBP2-13733] - Staining of human stomach, upper shows moderate membranous and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

PARP8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPLHLFSTLRRSPSYPPPG CGKSKSKLKSEQDGISK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
PARP8 Protein (NBP2-13733PEP)

Alternate Names for PARP8 Antibody

  • EC
  • FLJ21308
  • MGC42864
  • PARP-8
  • pART16
  • poly (ADP-ribose) polymerase family, member 8
  • poly [ADP-ribose] polymerase 8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mouse, Rat
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PARP8 Antibody (NBP2-13733) (0)

There are no publications for PARP8 Antibody (NBP2-13733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP8 Antibody (NBP2-13733) (0)

There are no reviews for PARP8 Antibody (NBP2-13733). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARP8 Antibody (NBP2-13733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PARP8 Antibody Products

Related Products by Gene

Bioinformatics Tool for PARP8 Antibody (NBP2-13733)

Discover related pathways, diseases and genes to PARP8 Antibody (NBP2-13733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PARP8 Antibody (NBP2-13733)

View related products by pathway.

Research Areas for PARP8 Antibody (NBP2-13733)

Find related products by research area.

Blogs on PARP8

There are no specific blogs for PARP8, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol PARP8

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-13733 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought