PARP8 Antibody

Western Blot: PARP8 Antibody [NBP2-13733] - Analysis in human cell line THP-1.

Immunocytochemistry/Immunofluorescence: PARP8 Antibody [NBP2-13733] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PARP8 Antibody [NBP2-13733] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PARP8 Antibody [NBP2-13733] - Staining of human small intestine shows weak membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: PARP8 Antibody [NBP2-13733] - Staining of human Fallopian tube shows weak positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: PARP8 Antibody [NBP2-13733] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Product Discontinued

PARP8 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: IMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPLHLFSTLRRSPSYPPPGCGKSKSKLKSEQDGISK
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PARP8 Antibody

• ARTD16
• EC 2.4.2.30
• FLJ21308
• MGC42864
• PARP8
• PARP-8
• pART16
• poly (ADP-ribose) polymerase family, member 8
• poly [ADP-ribose] polymerase 8

Background

Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition ofmultiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to glu/asp residues onthe substrate protein, and also polymerizes ADP-ribose to form long/branched chain polymers. PARP inhibitors are beingdeveloped for use in a number of pathologies including cancer, diabetes, stroke and cardiovascular disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARP8