PARP11 Antibody

Images

 
Western Blot: PARP11 Antibody [NBP2-85441] - WB Suggested Anti-PARP11 Antibody. Titration: 2.5 ug/ml. Positive Control: HepG2 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

PARP11 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human PARP11. Peptide sequence: SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PARP11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for PARP11 Antibody

  • ARTD11
  • C12orf6
  • chromosome 12 open reading frame 6
  • DKFZp779H0122
  • EC 2.4.2.30
  • MIB006
  • PARP11
  • PARP-11
  • poly (ADP-ribose) polymerase family, member 11
  • poly [ADP-ribose] polymerase 11

Background

Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition ofmultiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to glu/asp residues onthe substrate protein, and also polymerizes ADP-ribose to form long/branched chain polymers. PARP inhibitors are beingdeveloped for use in a number of pathologies including cancer, diabetes, stroke and cardiovascular disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARP11 Antibody (NBP2-85441) (0)

There are no publications for PARP11 Antibody (NBP2-85441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP11 Antibody (NBP2-85441) (0)

There are no reviews for PARP11 Antibody (NBP2-85441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP11 Antibody (NBP2-85441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARP11 Products

Research Areas for PARP11 Antibody (NBP2-85441)

Find related products by research area.

Blogs on PARP11

There are no specific blogs for PARP11, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP11