OR5H15 Antibody

Images

 
Western Blot: OR5H15 Antibody [NBP3-09804] - Western blot analysis of OR5H15 in Fetal Kidney lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OR5H15 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5H15 (NP_001005515). Peptide sequence FLMVFIFSGSIQVFSIVTILISYTFVLFTVLEKKSDKGVRKAFSTCGAHL
Clonality
Polyclonal
Host
Rabbit
Gene
OR5H15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for OR5H15 Antibody

  • olfactory receptor 5H15
  • olfactory receptor, family 5, subfamily H, member 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OR5H15 Antibody (NBP3-09804) (0)

There are no publications for OR5H15 Antibody (NBP3-09804).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR5H15 Antibody (NBP3-09804) (0)

There are no reviews for OR5H15 Antibody (NBP3-09804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR5H15 Antibody (NBP3-09804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OR5H15 Products

Array NBP3-09804

Bioinformatics Tool for OR5H15 Antibody (NBP3-09804)

Discover related pathways, diseases and genes to OR5H15 Antibody (NBP3-09804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OR5H15

There are no specific blogs for OR5H15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR5H15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OR5H15