We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

OR5B3 Antibody - BSA Free

Images

 
Western Blot: OR5B3 Antibody [NBP3-09798] - Western blot analysis of OR5B3 in Human COLO205 Whole Cell. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

OR5B3 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5B3 (NP_001005469). Peptide sequence SSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFKKVVEKAKLSV
Clonality
Polyclonal
Host
Rabbit
Gene
OR5B3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for OR5B3 Antibody - BSA Free

  • Olfactory receptor 5B13
  • olfactory receptor 5B3
  • Olfactory receptor OR11-239
  • olfactory receptor, family 5, subfamily B, member 13
  • olfactory receptor, family 5, subfamily B, member 3
  • OR11-239
  • OR5B13
  • OST129

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OR5B3 Antibody (NBP3-09798) (0)

There are no publications for OR5B3 Antibody (NBP3-09798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR5B3 Antibody (NBP3-09798) (0)

There are no reviews for OR5B3 Antibody (NBP3-09798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR5B3 Antibody (NBP3-09798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OR5B3 Products

Array NBP3-09798

Research Areas for OR5B3 Antibody (NBP3-09798)

Find related products by research area.

Blogs on OR5B3

There are no specific blogs for OR5B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR5B3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol OR5B3