We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

OR1F1 Antibody - BSA Free

Images

 
Western Blot: OR1F1 Antibody [NBP3-09758] - Western blot analysis of OR1F1 in Jurkat Whole Cell. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

OR1F1 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1F1 (NP_036492.1). Peptide sequence FNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVV
Clonality
Polyclonal
Host
Rabbit
Gene
OR1F1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for OR1F1 Antibody - BSA Free

  • Olfactory receptor 16-35
  • olfactory receptor 1F1
  • Olfactory receptor 1F10
  • Olfactory receptor 1F4
  • Olfactory receptor 1F5
  • Olfactory receptor 1F6
  • Olfactory receptor 1F7
  • Olfactory receptor 1F8
  • Olfactory receptor 1F9
  • Olfactory receptor OR16-4
  • olfactory receptor, family 1, subfamily F, member 1
  • olfactory receptor, family 1, subfamily F, member 13 pseudogene
  • olfactory receptor, family 1, subfamily F, member 4
  • olfactory receptor, family 1, subfamily F, member 5
  • olfactory receptor, family 1, subfamily F, member 6
  • olfactory receptor, family 1, subfamily F, member 7
  • olfactory receptor, family 1, subfamily F, member 9
  • Olfmf
  • OLFMFolfactory receptor, family 1, subfamily F, member 10
  • OR16-35
  • OR16-36
  • OR16-37
  • OR16-88
  • OR16-89
  • OR16-90
  • OR1F10
  • OR1F13P
  • OR1F4
  • OR1F5
  • OR1F6
  • OR1F7
  • OR1F8
  • OR1F9
  • OR3-145
  • ORL1023

Background

OR1F1, also known as Olfactory receptor 1F1, is a 34.9 kDa, 312 amino acid protein that is involved in receiving signals from odor molecules and triggering a neuronal response that will initiate the perception of smell. Diseases such as neuronitis and familial Mediterranean fever are currently being researched with this protein. The protein interacts with GNAL, GNGT1, OR2C1, OR10A3, and OR52E6 proteins in olfactory and GPCR signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OR1F1 Antibody (NBP3-09758) (0)

There are no publications for OR1F1 Antibody (NBP3-09758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR1F1 Antibody (NBP3-09758) (0)

There are no reviews for OR1F1 Antibody (NBP3-09758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR1F1 Antibody (NBP3-09758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR1F1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol OR1F1