NUDT8 Antibody

Images

 
Western Blot: NUDT8 Antibody [NBP2-87964] - Host: Rabbit. Target Name: NUDT8. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDT8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT8. Peptide sequence: SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Canine (93%), Equine (100%), Bovine (93%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDT8 Antibody

  • EC 3.6.1.-
  • FLJ41567
  • nucleoside diphosphate-linked moiety X motif 8, mitochondrial
  • nudix (nucleoside diphosphate linked moiety X)-type motif 8
  • Nudix motif 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUDT8 Antibody (NBP2-87964) (0)

There are no publications for NUDT8 Antibody (NBP2-87964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT8 Antibody (NBP2-87964) (0)

There are no reviews for NUDT8 Antibody (NBP2-87964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT8 Antibody (NBP2-87964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUDT8 Products

Bioinformatics Tool for NUDT8 Antibody (NBP2-87964)

Discover related pathways, diseases and genes to NUDT8 Antibody (NBP2-87964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NUDT8 Antibody (NBP2-87964)

Find related products by research area.

Blogs on NUDT8

There are no specific blogs for NUDT8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT8