NTN5 Antibody

Images

 
Western Blot: NTN5 Antibody [H00126147-B01P] - Analysis of NTN5 expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: NTN5 Antibody [H00126147-B01P] - Analysis of purified antibody to NTN5 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: NTN5 Antibody [H00126147-B01P] - Analysis of NTN5 expression in transfected 293T cell line by NTN5 polyclonal antibody. Lane 1: NTN5 transfected lysate(53.79 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NTN5 Antibody Summary

Immunogen
NTN5 (NP_665806.1, 1 a.a. - 489 a.a.) full-length human protein. MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSPGNHLGARETCNGSLTLALGGPFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPGALGGPERVTFHSTPGPKATVAASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATGGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQDAWVPRADLTCGCLRLQPGTDYLLLGSAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCRGVRAPTPSPRPEH
Specificity
LOC126147,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NTN5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NTN5 Antibody

  • CNB2
  • netrin 5
  • Netrin-1-like protein
  • netrin-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NTN5 Antibody (H00126147-B01P) (0)

There are no publications for NTN5 Antibody (H00126147-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTN5 Antibody (H00126147-B01P) (0)

There are no reviews for NTN5 Antibody (H00126147-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NTN5 Antibody (H00126147-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NTN5 Products

Array H00126147-B01P

Bioinformatics Tool for NTN5 Antibody (H00126147-B01P)

Discover related pathways, diseases and genes to NTN5 Antibody (H00126147-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NTN5

There are no specific blogs for NTN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NTN5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN5
Entrez
Uniprot