![Western Blot: MYLK4 Antibody (7A3) [H00340156-M01-100ug] - Detection against Immunogen (36.52 KDa) .](http://images.novusbio.com/fullsize/MYLK4-Antibody-7A3-Western-Blot-H00340156-M01-100ug-img0003.jpg "Western Blot: MYLK4 Antibody (7A3) [H00340156-M01-100ug] - Detection against Immunogen (36.52 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 7A3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse MYLK4 Antibody (7A3) - Azide and BSA Free (H00340156-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | MYLK4 (NP_001012418.1, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAV |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MYLK4 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MYLK4 Antibody (H00340156-M01-100ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYLK4 |
| Entrez |
|
| Uniprot |
|
![Western Blot: MYLK4 Antibody (7A3) [H00340156-M01-100ug] - Analysis of MYLK4 expression in Jurkat.](http://images.novusbio.com/fullsize/MYLK4-Antibody-7A3-Western-Blot-H00340156-M01-100ug-img0002.jpg "Western Blot: MYLK4 Antibody (7A3) [H00340156-M01-100ug] - Analysis of MYLK4 expression in Jurkat.")
![ELISA: MYLK4 Antibody (7A3) [H00340156-M01-100ug] - Detection limit for recombinant GST tagged MYLK4 is 10 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/MYLK4-Antibody-7A3-ELISA-H00340156-M01-100ug-img0001.jpg "ELISA: MYLK4 Antibody (7A3) [H00340156-M01-100ug] - Detection limit for recombinant GST tagged MYLK4 is 10 ng/ml as a capture antibody.")
