MRPS33 Antibody - BSA Free

Western Blot: MRPS33 Antibody [NBP2-85326] - Host: Rabbit. Target Name: RT33. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Discontinued

MRPS33 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MRPS33. Peptide sequence: KKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRPS33 Antibody - BSA Free

• CGI-139
• FLJ21123
• mitochondrial ribosomal protein S33,28S ribosomal protein S33, mitochondrial
• MRP-S33
• PTD003
• S33mt

Background

MRPS33, or Mitochondrial Ribosomal Protein S33, consists of a 106 amino acid isoform that is 13 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. There is no current research being conducted on the relationship between MRPS33 and any diseases or disorders. MRPS33 has been linked to the process of translation, and has been found to interact with UBC, C12orf4, MDM2, PIK3C3, and SCHIP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS33