MRPS33 Antibody - BSA Free

Images

 
Western Blot: MRPS33 Antibody [NBP2-85326] - Host: Rabbit. Target Name: RT33. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Product Discontinued
View other related MRPS33 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-85326
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MRPS33 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MRPS33. Peptide sequence: KKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS33
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for MRPS33 Antibody - BSA Free

  • CGI-139
  • FLJ21123
  • mitochondrial ribosomal protein S33,28S ribosomal protein S33, mitochondrial
  • MRP-S33
  • PTD003
  • S33mt

Background

MRPS33, or Mitochondrial Ribosomal Protein S33, consists of a 106 amino acid isoform that is 13 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. There is no current research being conducted on the relationship between MRPS33 and any diseases or disorders. MRPS33 has been linked to the process of translation, and has been found to interact with UBC, C12orf4, MDM2, PIK3C3, and SCHIP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82756
Species: Hu
Applications: IHC,  IHC-P
NBP2-85326
Species: Hu
Applications: WB

Publications for MRPS33 Antibody (NBP2-85326) (0)

There are no publications for MRPS33 Antibody (NBP2-85326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS33 Antibody (NBP2-85326) (0)

There are no reviews for MRPS33 Antibody (NBP2-85326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS33 Antibody (NBP2-85326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS33 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS33