MGME1 Antibody

Images

 
Western Blot: MGME1 Antibody [NBP2-83204] - Host: Rabbit. Target Name: C20ORF72. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MGME1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human MGME1. Peptide sequence: CGLIVVAYKDGSPAHPHFMDAELCSQYWTKWLLRLEEYTEKKKNQNIQKP
Clonality
Polyclonal
Host
Rabbit
Gene
C20ORF72
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MGME1 Antibody

  • bA504H3.4
  • chromosome 20 open reading frame 72
  • FLJ14597
  • hypothetical protein LOC92667

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MGME1 Antibody (NBP2-83204) (0)

There are no publications for MGME1 Antibody (NBP2-83204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGME1 Antibody (NBP2-83204) (0)

There are no reviews for MGME1 Antibody (NBP2-83204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGME1 Antibody (NBP2-83204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MGME1 Products

Bioinformatics Tool for MGME1 Antibody (NBP2-83204)

Discover related pathways, diseases and genes to MGME1 Antibody (NBP2-83204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MGME1

There are no specific blogs for MGME1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGME1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C20ORF72