MEIOB Antibody


Western Blot: MEIOB Antibody [NBP2-85269] - Host: Rabbit. Target: MEIOB. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): Human Liver (LI). Antibody concentration: 1ug/ml
Western Blot: MEIOB Antibody [NBP2-85269] - Host: Rabbit. Target Name: MEIOB. Sample Type: Uterus Tumor lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MEIOB Antibody [NBP2-85269] - Host: Rabbit. Target Name: MEIOB. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Reactivity Hu, EqSpecies Glossary
Applications WB

Order Details

MEIOB Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MEIOB. Peptide sequence: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for MEIOB Antibody

  • C16orf73
  • chromosome 16 open reading frame 73
  • gs129
  • meiosis specific with OB domains


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MEIOB Antibody (NBP2-85269) (0)

There are no publications for MEIOB Antibody (NBP2-85269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEIOB Antibody (NBP2-85269) (0)

There are no reviews for MEIOB Antibody (NBP2-85269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEIOB Antibody (NBP2-85269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MEIOB Products

Array NBP2-85269

Bioinformatics Tool for MEIOB Antibody (NBP2-85269)

Discover related pathways, diseases and genes to MEIOB Antibody (NBP2-85269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MEIOB

There are no specific blogs for MEIOB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MEIOB Antibody and receive a gift card or discount.


Gene Symbol MEIOB