MEGF11 Antibody

Images

 
Immunohistochemistry: MEGF11 Antibody [NBP2-14226] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEGF11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAV SCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTW GLNCNESCTCANGAACSPIDGSCSCTPGWLGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEGF11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEGF11 Protein (NBP2-14226PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEGF11 Antibody

  • DKFZp434L121
  • KIAA1781
  • multiple EGF-like domains protein 11
  • multiple EGF-like-domains 11
  • multiple epidermal growth factor-like domains protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14010
Species: Hu
Applications: IHC, IHC-P
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14226
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MEGF11 Antibody (NBP2-14226) (0)

There are no publications for MEGF11 Antibody (NBP2-14226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGF11 Antibody (NBP2-14226) (0)

There are no reviews for MEGF11 Antibody (NBP2-14226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEGF11 Antibody (NBP2-14226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEGF11 Products

MEGF11 NBP2-14226

Bioinformatics Tool for MEGF11 Antibody (NBP2-14226)

Discover related pathways, diseases and genes to MEGF11 Antibody (NBP2-14226). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEGF11 Antibody (NBP2-14226)

Discover more about diseases related to MEGF11 Antibody (NBP2-14226).
 

Pathways for MEGF11 Antibody (NBP2-14226)

View related products by pathway.

Blogs on MEGF11

There are no specific blogs for MEGF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEGF11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEGF11