MAGEA8 Antibody

Images

 
Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in mouse spleen.
Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in human kidney.
Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in human liver.
Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in transfected 293T cell line by MAGEA8 polyclonal antibody.Lane 1: MAGEA8 transfected lysate(35.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEA8 Antibody Summary

Immunogen
MAGEA8 (NP_005355.2, 1 a.a. - 318 a.a.) full-length human protein. MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Specificity
MAGEA8 - melanoma antigen family A, 8,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEA8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA8 Antibody

  • Cancer/testis antigen 1.8
  • CT1.8MAGE-8 antigen
  • MAGE8cancer/testis antigen family 1, member 8
  • melanoma antigen family A, 8
  • melanoma-associated antigen 8
  • MGC2182

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAGEA8 Antibody (H00004107-D01P) (0)

There are no publications for MAGEA8 Antibody (H00004107-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA8 Antibody (H00004107-D01P) (0)

There are no reviews for MAGEA8 Antibody (H00004107-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA8 Antibody (H00004107-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEA8 Products

Bioinformatics Tool for MAGEA8 Antibody (H00004107-D01P)

Discover related pathways, diseases and genes to MAGEA8 Antibody (H00004107-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MAGEA8

There are no specific blogs for MAGEA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA8
Entrez
Uniprot