MAGEA8 Antibody

Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in mouse spleen.

Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in human kidney.

Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in human liver.

Western Blot: MAGEA8 Antibody [H00004107-D01P] - Analysis of MAGEA8 expression in transfected 293T cell line by MAGEA8 polyclonal antibody.Lane 1: MAGEA8 transfected lysate(35.20 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAGEA8 Antibody Summary

• Immunogen: MAGEA8 (NP_005355.2, 1 a.a. - 318 a.a.) full-length human protein. MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
• Specificity: MAGEA8 - melanoma antigen family A, 8,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGEA8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA8 Antibody

• Cancer/testis antigen 1.8
• CT1.8MAGE-8 antigen
• MAGE8cancer/testis antigen family 1, member 8
• melanoma antigen family A, 8
• melanoma-associated antigen 8
• MGC2182

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGEA8
• Entrez:
  • 4107(Human)
• Uniprot:
  • NP_005355.2(Human)