![Western Blot: LYSMD4 Antibody [H00145748-B01P] - Analysis of LYSMD4 expression in human kidney.](http://images.novusbio.com/fullsize/LYSMD4-Antibody-Western-Blot-H00145748-B01P-img0001.jpg "Western Blot: LYSMD4 Antibody [H00145748-B01P] - Analysis of LYSMD4 expression in human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse LYSMD4 Antibody - Azide and BSA Free (H00145748-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | LYSMD4 (NP_689662.2, 1 a.a. - 297 a.a.) full-length human protein. MAVGTRGTLLKKSLTVWFCGPGARSATRAVSTSLPRREQVTWCCCSGSWPRRTASTSWRCSMAANFCRHTVWLTEHGLKNEACPTKTGIDGVGFLVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | LYSMD4 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LYSMD4 |
| Uniprot |
|
![Western Blot: LYSMD4 Antibody [H00145748-B01P] - Analysis of LYSMD4 expression in transfected 293T cell line by LYSMD4 polyclonal antibody. Lane 1: LYSMD4 transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LYSMD4-Antibody-Western-Blot-H00145748-B01P-img0002.jpg "Western Blot: LYSMD4 Antibody [H00145748-B01P] - Analysis of LYSMD4 expression in transfected 293T cell line by LYSMD4 polyclonal antibody. Lane 1: LYSMD4 transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")