LRRC74A Antibody

Images

 
Western Blot: LRRC74A Antibody [NBP2-83163] - Host: Rabbit. Target Name: C14orf166B. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC74A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRRC74A. Peptide sequence: GMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKPARENSETDLEIEDDE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC74A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC74A Antibody

  • C14orf166B
  • chromosome 14 open reading frame 166B
  • hypothetical protein LOC145497
  • leucine rich repeat containing 74
  • leucine-rich repeat-containing protein 74
  • leucine-rich repeat-containing protein 74A
  • LRRC74

Background

LRRC74A is a gene that codes for a protein that has two isoforms, measuring 488 and 219 amino acids in length and weighing approximately 55 and 24 kDa respectively. LRRC74A has been shown to have interactions with ADAM10, ANXA6, CD19, CD63, and CD81.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRC74A Antibody (NBP2-83163) (0)

There are no publications for LRRC74A Antibody (NBP2-83163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC74A Antibody (NBP2-83163) (0)

There are no reviews for LRRC74A Antibody (NBP2-83163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC74A Antibody (NBP2-83163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC74A Products

Bioinformatics Tool for LRRC74A Antibody (NBP2-83163)

Discover related pathways, diseases and genes to LRRC74A Antibody (NBP2-83163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRRC74A

There are no specific blogs for LRRC74A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC74A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC74A