LOC541473 Antibody

Images

 
Western Blot: LOC541473 Antibody [H00541473-B01P-50ug] - Western Blot analysis of LOC541473 expression in transfected 293T cell line by LOC541473 MaxPab polyclonal antibody.Lane 1: LOC541473 transfected lysate (14.41 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LOC541473 Antibody Summary

Immunogen
LOC541473 (NP_001013770.1, 1 a.a. - 131 a.a.) full-length human protein. MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LOC541473
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LOC541473 Antibody

  • FK506 Binding Protein 6, 36kDa Pseudogene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LOC541473 Antibody (H00541473-B01P-50ug) (0)

There are no publications for LOC541473 Antibody (H00541473-B01P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOC541473 Antibody (H00541473-B01P-50ug) (0)

There are no reviews for LOC541473 Antibody (H00541473-B01P-50ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LOC541473 Antibody (H00541473-B01P-50ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LOC541473 Products

Array H00541473-B01P-50ug

Bioinformatics Tool for LOC541473 Antibody (H00541473-B01P-50ug)

Discover related pathways, diseases and genes to LOC541473 Antibody (H00541473-B01P-50ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LOC541473

There are no specific blogs for LOC541473, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LOC541473 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LOC541473
Entrez
Uniprot