LIN-61 Antibody

Images

 
Western Blot: LIN-61 Antibody [29590002] - This image is specific to animal number Q0824 1:500 Nuclear extract validation
Immunocytochemistry/ Immunofluorescence: LIN-61 Antibody [29590002] - This image is specific to animal number Q0824 Nuclear signal decreased after RNAi lin-61 but didn't go away completely. Antibody dilution 1:1000
Western Blot: LIN-61 Antibody [29590002] - Detection of C. elegans LIN61 at a dilution of 1:3,000. LIN61 appeared at 57 kDa. Image courtesy of University of Cambridge, Ahringer Lab.
Immunocytochemistry/ Immunofluorescence: LIN-61 Antibody [29590002] - Staining of LIN 61 antibody at a dilution of 1:1,000. Image courtesy of University of Cambridge, Ahringer Lab.

Product Details

Summary
Reactivity CeSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

LIN-61 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
ITKKDFPESLPDADDDRQVFSSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTFDQLAKDPIDPMIWRKVKVGQ
Specificity
This antibody is specific to C. elegans LIN61
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIN61
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This product is useful for ELISA, Western Blot, and Immunofluorescence.
Publications
Read Publications using 29590002.

Reactivity Notes

C. elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Background

lin-61 encodes a protein that contains four malignant brain tumor (MBT) repeats and is similar to the human and mouse lethal (3) malignant brain tumor 2 [L(3)MBT2] proteins; LIN-61 is predicted to function in a transcriptional regulatory complex that may play a role in transcriptional repression during development; loss of lin-61 activity via RNAi and mutation indicates that LIN-61 is required for: 1) genome stability in the soma and germline, and 2) postembryonic developmental processes such as vulval development, in which lin-61 acts as a class B synthetic multivulval (SynMuv) gene and as a candidate transcriptional repressor of genes such at mat-3; LIN-61 is broadly expressed throughout development, from the one-cell embryo through adulthood, and localizes to nuclei.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for LIN-61 Antibody (29590002)(2)

Reviews for LIN-61 Antibody (29590002) (0)

There are no reviews for LIN-61 Antibody (29590002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIN-61 Antibody (29590002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIN-61 Products

LIN-61 29590002

Bioinformatics Tool for LIN-61 Antibody (29590002)

Discover related pathways, diseases and genes to LIN-61 Antibody (29590002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for LIN-61 Antibody (29590002)

Find related products by research area.

Blogs on LIN-61

There are no specific blogs for LIN-61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIN-61 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN61
Entrez