We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LDLRAD3 Antibody

Images

 
Western Blot: LDLRAD3 Antibody [NBP1-86261] - Analysis in control (vector only transfected HEK293T lysate) and LDLRAD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: LDLRAD3 Antibody [NBP1-86261] - Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LDLRAD3 Antibody [NBP1-86261] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related LDLRAD3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86261
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LDLRAD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPA
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LDLRAD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using NBP1-86261.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LDLRAD3 Antibody

  • low density lipoprotein receptor class A domain containing 3
  • low-density lipoprotein receptor class A domain-containing protein 3

Background

Low-density lipoprotein receptor class A domain-containing 3 (LDLRAD3) is a protein that plays an important role in cholesterol metabolism. The receptor protein binds LDL and transports it into cells through endocytosis. Additionally, there is evidence that Hepatitis C and other viruses enter cells through the mediation of LDL receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86261
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for LDLRAD3 Antibody (NBP1-86261)(1)

We have publications tested in 2 applications: Immunohistochemistry, Immunohistochemistry-Paraffin.


Filter By Application
Immunohistochemistry
(1)
Immunohistochemistry-Paraffin
(1)
All Applications
Filter By Species
All Species

Reviews for LDLRAD3 Antibody (NBP1-86261) (0)

There are no reviews for LDLRAD3 Antibody (NBP1-86261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LDLRAD3 Antibody (NBP1-86261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LDLRAD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDLRAD3