LDLRAD3 Antibody

Western Blot: LDLRAD3 Antibody [NBP1-86261] - Analysis in control (vector only transfected HEK293T lysate) and LDLRAD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: LDLRAD3 Antibody [NBP1-86261] - Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LDLRAD3 Antibody [NBP1-86261] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.

Product Discontinued

LDLRAD3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPA
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LDLRAD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LDLRAD3 Antibody

• low density lipoprotein receptor class A domain containing 3
• low-density lipoprotein receptor class A domain-containing protein 3

Background

Low-density lipoprotein receptor class A domain-containing 3 (LDLRAD3) is a protein that plays an important role in cholesterol metabolism. The receptor protein binds LDL and transports it into cells through endocytosis. Additionally, there is evidence that Hepatitis C and other viruses enter cells through the mediation of LDL receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LDLRAD3 Antibody (NBP1-86261)(1)

Publication using NBP1-86261

• Williams EP, Xue Y, Lee J et al. Deep spatial profiling of Venezuelan equine encephalitis virus reveals increased genetic diversity amidst neuroinflammation and cell death during brain infection Journal of Virology 2023-08-31 [PMID: 37560924] (Immunohistochemistry, Immunohistochemistry-Paraffin)

Bioinformatics

• Gene Symbol: LDLRAD3