LCA5L Antibody

Images

 
Western Blot: LCA5L Antibody [NBP2-85204] - WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: MCF7 cell lysate

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LCA5L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LCA5L. Peptide sequence: GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
LCA5L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LCA5L Antibody

  • C21orf13
  • leber congenital amaurosis 5-like protein
  • Leber congenital amaurosis 5-like
  • Lebercilin-like protein
  • MGC33295

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LCA5L Antibody (NBP2-85204) (0)

There are no publications for LCA5L Antibody (NBP2-85204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCA5L Antibody (NBP2-85204) (0)

There are no reviews for LCA5L Antibody (NBP2-85204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCA5L Antibody (NBP2-85204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LCA5L Products

Array NBP2-85204

Bioinformatics Tool for LCA5L Antibody (NBP2-85204)

Discover related pathways, diseases and genes to LCA5L Antibody (NBP2-85204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LCA5L

There are no specific blogs for LCA5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCA5L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCA5L