Recombinant Human IFFO GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human IFFO GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-200 of Human HOM-TES-103 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
IFFO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFFO GST (N-Term) Protein

  • FLJ20703
  • intermediate filament family orphan 1
  • intermediate filament-like MGC:2625

Background

This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

5609-MU
Species: Hu
Applications: Bind
H00025900-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for IFFO Recombinant Protein (H00025900-P01) (0)

There are no publications for IFFO Recombinant Protein (H00025900-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFFO Recombinant Protein (H00025900-P01) (0)

There are no reviews for IFFO Recombinant Protein (H00025900-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFFO Recombinant Protein (H00025900-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFFO Products

Bioinformatics Tool for IFFO Recombinant Protein (H00025900-P01)

Discover related pathways, diseases and genes to IFFO Recombinant Protein (H00025900-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFFO Recombinant Protein (H00025900-P01)

Discover more about diseases related to IFFO Recombinant Protein (H00025900-P01).
 

Pathways for IFFO Recombinant Protein (H00025900-P01)

View related products by pathway.

PTMs for IFFO Recombinant Protein (H00025900-P01)

Learn more about PTMs related to IFFO Recombinant Protein (H00025900-P01).

Blogs on IFFO

There are no specific blogs for IFFO, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFFO GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFFO1