![Western Blot: HKR2 Antibody (3E9) [H00342945-M08] - Analysis of ZSCAN22 expression in HepG2.](http://images.novusbio.com/fullsize/HKR2-Antibody-3E9-Western-Blot-H00342945-M08-img0002.jpg "Western Blot: HKR2 Antibody (3E9) [H00342945-M08] - Analysis of ZSCAN22 expression in HepG2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3E9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | ZSCAN22 (NP_862829.1, 196 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT |
| Specificity | This product is specific for Human ZSCAN22 monoclonal antibody (M08), clone 3E9 [Gene ID: 342945]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ZSCAN22 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse monoclonal antibody raised against a partial recombinant ZSCAN22. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZSCAN22 |
| Uniprot |
|
![Sandwich ELISA: HKR2 Antibody (3E9) [H00342945-M08] - Detection limit for recombinant GST tagged ZSCAN22 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/HKR2-Antibody-3E9-Sandwich-ELISA-H00342945-M08-img0001.jpg "Sandwich ELISA: HKR2 Antibody (3E9) [H00342945-M08] - Detection limit for recombinant GST tagged ZSCAN22 is 0.3 ng/ml as a capture antibody.")
