HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 594]

Images

 
There are currently no images for HIV-1 Gag p24 Antibody (NBP2-41336AF594).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity V-ViSpecies Glossary
Applications WB, ELISA
Clone
8G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 594

Order Details

HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 594] Summary

Immunogen
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Specificity
By Western blot, anti-HIV-1 Gag p24 antibody detects a ~24 kDa, a ~41 kDa, and a ~55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
gag
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

0

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 594]

  • CA
  • Capsid Protein
  • HIV1 Gag p24
  • HIV-1 Gag p24
  • Pr55(Gag)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HIV-1 Gag p24 Antibody (NBP2-41336AF594) (0)

There are no publications for HIV-1 Gag p24 Antibody (NBP2-41336AF594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIV-1 Gag p24 Antibody (NBP2-41336AF594) (0)

There are no reviews for HIV-1 Gag p24 Antibody (NBP2-41336AF594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIV-1 Gag p24 Antibody (NBP2-41336AF594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 594] and receive a gift card or discount.

Bioinformatics

Gene Symbol gag