Recombinant HBsAg Protein

Product Discontinued

Recombinant HBsAg Protein Summary

• Description: HBsAg (preS1) Recombinant Protein
  
  Source: E. coli
  
  Amino Acid Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
• Preparation Method: Escherichia coli expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: S

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Application Notes: This product is useful for SDS-PAGE.

Reactivity Notes

Virus

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: In 20 mM PB, 50 mM NaCl, pH 7.4
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant HBsAg Protein

• HBsAg
• HBV major surface antigen
• HBV surface antigen
• Hepatitis B Virus major surface antigen
• Hepatitis B Virus Surface Antigen
• Major surface antigen
• protein S

Background

Hepatitis B Virus (HBV) infection induces a disease state which manifests itself in a variety of ways, characterized by the extent of liver damage, inflammation and viral persistence. HBV infection is also associated with a 100 fold increased risk of hepatocellular carcinoma and currently infects over 250 million people worldwide. HBV has a partially double stranded 3.2 kilobase DNA genome which contains four open reading frames. One of these encodes a 154 amino acid protein called the HBx protein. HBx has been shown to be a transcriptional transactivator of both viral and cellular promoters. Lacking a DNA binding domain and nuclear localization signal, HBx is believed to exert transcriptional activity through protein protein interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: S