Recombinant HBsAg Protein

Images

 

Product Details

Summary
Product Discontinued
View other related HBsAg Peptides and Proteins

Order Details


    • Catalog Number
      P4876
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant HBsAg Protein Summary

Description
HBsAg (preS1) Recombinant Protein

Source: E. coli

Amino Acid Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Preparation
Method
Escherichia coli expression system
Protein/Peptide Type
Recombinant Protein
Gene
S

Applications/Dilutions

Dilutions
  • SDS-Page
Application Notes
This product is useful for SDS-PAGE.

Reactivity Notes

Virus

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
In 20 mM PB, 50 mM NaCl, pH 7.4
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant HBsAg Protein

  • HBsAg
  • HBV major surface antigen
  • HBV surface antigen
  • Hepatitis B Virus major surface antigen
  • Hepatitis B Virus Surface Antigen
  • Major surface antigen
  • protein S

Background

Hepatitis B Virus (HBV) infection induces a disease state which manifests itself in a variety of ways, characterized by the extent of liver damage, inflammation and viral persistence. HBV infection is also associated with a 100 fold increased risk of hepatocellular carcinoma and currently infects over 250 million people worldwide. HBV has a partially double stranded 3.2 kilobase DNA genome which contains four open reading frames. One of these encodes a 154 amino acid protein called the HBx protein. HBx has been shown to be a transcriptional transactivator of both viral and cellular promoters. Lacking a DNA binding domain and nuclear localization signal, HBx is believed to exert transcriptional activity through protein protein interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for HBsAg Recombinant Protein (P4876) (0)

There are no publications for HBsAg Recombinant Protein (P4876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBsAg Recombinant Protein (P4876) (0)

There are no reviews for HBsAg Recombinant Protein (P4876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HBsAg Recombinant Protein (P4876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HBsAg Products

Research Areas for HBsAg Recombinant Protein (P4876)

Find related products by research area.

Blogs on HBsAg

There are no specific blogs for HBsAg, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant HBsAg Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S