Recombinant HBsAg Protein Summary
| Description |
HBsAg (preS1) Recombinant Protein
Source: E. coli
Amino Acid Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA |
Preparation Method |
Escherichia coli expression system |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
S |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product is useful for SDS-PAGE. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
In 20 mM PB, 50 mM NaCl, pH 7.4 |
| Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant HBsAg Protein
Background
Hepatitis B Virus (HBV) infection induces a disease state which manifests itself in a variety of ways, characterized by the extent of liver damage, inflammation and viral persistence. HBV infection is also associated with a 100 fold increased risk of hepatocellular carcinoma and currently infects over 250 million people worldwide. HBV has a partially double stranded 3.2 kilobase DNA genome which contains four open reading frames. One of these encodes a 154 amino acid protein called the HBx protein. HBx has been shown to be a transcriptional transactivator of both viral and cellular promoters. Lacking a DNA binding domain and nuclear localization signal, HBx is believed to exert transcriptional activity through protein protein interaction.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Publications for HBsAg Recombinant Protein (P4876) (0)
There are no publications for HBsAg Recombinant Protein (P4876).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HBsAg Recombinant Protein (P4876) (0)
There are no reviews for HBsAg Recombinant Protein (P4876).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HBsAg Recombinant Protein (P4876) (0)
Additional HBsAg Products
Research Areas for HBsAg Recombinant Protein (P4876)
Find related products by research area.
|
Blogs on HBsAg