We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GIMAP6 Antibody

Images

 
Western Blot: GIMAP6 Antibody [NBP1-79618] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Product Details

Summary
Product Discontinued
View other related GIMAP6 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-79618
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GIMAP6 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the C terminal of human GIMAP6The immunogen for this antibody is GIMAP6. Peptide sequence GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIMAP6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GIMAP6 Antibody

  • DKFZp686A01175
  • FLJ22690
  • GTPase IMAP family member 6
  • GTPase, IMAP family member 6
  • hIAN2
  • hIAN6
  • human immune associated nucleotide 2
  • IAN2
  • IAN-2
  • IAN6
  • IAN-6
  • immune associated nucleotide 2
  • immune associated nucleotide 6
  • Immunity-associated nucleotide 2 protein
  • Immunity-associated nucleotide 6 protein

Background

GIMAP6 encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03730
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85059
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81625
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-31165
Species: Hu
Applications: IHC,  IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB

Publications for GIMAP6 Antibody (NBP1-79618) (0)

There are no publications for GIMAP6 Antibody (NBP1-79618).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIMAP6 Antibody (NBP1-79618) (0)

There are no reviews for GIMAP6 Antibody (NBP1-79618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIMAP6 Antibody (NBP1-79618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GIMAP6 Products

Research Areas for GIMAP6 Antibody (NBP1-79618)

Find related products by research area.

Blogs on GIMAP6

There are no specific blogs for GIMAP6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIMAP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIMAP6
Uniprot