FRMD8 Antibody

Images

 
Western Blot: FRMD8 Antibody [H00083786-B01P] - Analysis of FKSG44 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: FRMD8 Antibody [H00083786-B01P] - Analysis of purified antibody to FRMD8 on HeLa cell. (antibody concentration 20 ug/ml)
Western Blot: FRMD8 Antibody [H00083786-B01P] - Analysis of FRMD8 expression in Raw 264.7.
Western Blot: FRMD8 Antibody [H00083786-B01P] - Analysis of FRMD8 expression in transfected 293T cell line by FRMD8 polyclonal antibody. Lane 1: FKSG44 transfected lysate(51.04 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FRMD8 Antibody Summary

Immunogen
FRMD8 (NP_114110.1, 1 a.a. - 464 a.a.) full-length human protein. MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG
Specificity
FRMD8 - FERM domain containing 8,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FRMD8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.
Publications
Read Publication using H00083786-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FRMD8 Antibody

  • FERM domain containing 8
  • FERM domain-containing protein 8
  • FKSG44
  • FLJ32216
  • FLJ90369
  • MGC31785

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FRMD8 Antibody (H00083786-B01P)(1)

Reviews for FRMD8 Antibody (H00083786-B01P) (0)

There are no reviews for FRMD8 Antibody (H00083786-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FRMD8 Antibody (H00083786-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FRMD8 Products

Bioinformatics Tool for FRMD8 Antibody (H00083786-B01P)

Discover related pathways, diseases and genes to FRMD8 Antibody (H00083786-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FRMD8

There are no specific blogs for FRMD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRMD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRMD8
Entrez
Uniprot