FOXL2NB Antibody


Western Blot: FOXL2NB Antibody [NBP2-84940] - Host: Rabbit. Target Name: C3orf72. Sample Type: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FOXL2NB Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3orf72. Peptide sequence: PKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEAG The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for FOXL2NB Antibody

  • C3orf72
  • Chromosome 3 Open Reading Frame 72
  • FLJ43329 Protein
  • FOXL2 Neighbor Protein
  • FOXL2 Neighbor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FOXL2NB Antibody (NBP2-84940) (0)

There are no publications for FOXL2NB Antibody (NBP2-84940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXL2NB Antibody (NBP2-84940) (0)

There are no reviews for FOXL2NB Antibody (NBP2-84940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXL2NB Antibody (NBP2-84940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FOXL2NB Products

Bioinformatics Tool for FOXL2NB Antibody (NBP2-84940)

Discover related pathways, diseases and genes to FOXL2NB Antibody (NBP2-84940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FOXL2NB

There are no specific blogs for FOXL2NB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FOXL2NB Antibody and receive a gift card or discount.


Gene Symbol FOXL2NB