FLJ23356 Antibody (6F10)

Images

 
Western Blot: FLJ23356 Antibody (6F10) [H00084197-M03] - Analysis of FLJ23356 expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: FLJ23356 Antibody (6F10) [H00084197-M03] - Analysis of monoclonal antibody to FLJ23356 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: FLJ23356 Antibody (6F10) [H00084197-M03] - Western blot analysis of FLJ23356 over-expressed 293 cell line, cotransfected with FLJ23356 Validated Chimera RNAi or non-transfected control. Blot probed with ...read more
Western Blot: FLJ23356 Antibody (6F10) [H00084197-M03] - Analysis of FLJ23356 expression in HeLa(Cat # L013V1).
Western Blot: FLJ23356 Antibody (6F10) [H00084197-M03] - Analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody (M03), clone 6F10. Lane 1: FLJ23356 transfected lysatE (38.5 KDa). ...read more
ELISA: FLJ23356 Antibody (6F10) [H00084197-M03] - Detection limit for recombinant GST tagged FLJ23356 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-Fr
Clone
6F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FLJ23356 Antibody (6F10) Summary

Immunogen
FLJ23356 (NP_115613, 251 a.a. ~ 351 a.a) partial recombinant protein with GST tag.GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFL LGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKV LDTLRDAMMSQAREML
Specificity
FLJ23356 - hypothetical protein FLJ23356
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGK196
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Frozen
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24556084)
Publications
Read Publication using
H00084197-M03 in the following applications:

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FLJ23356 Antibody (6F10)

  • FLJ23356
  • MGC126597
  • protein kinase-like protein SgK196
  • Sugen kinase 196

Background

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ23356 Antibody (H00084197-M03)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC-Fr, WB.


Filter By Application
ICC/IF
(1)
IHC-Fr
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FLJ23356 Antibody (H00084197-M03) (0)

There are no reviews for FLJ23356 Antibody (H00084197-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLJ23356 Antibody (H00084197-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ23356 Products

Bioinformatics Tool for FLJ23356 Antibody (H00084197-M03)

Discover related pathways, diseases and genes to FLJ23356 Antibody (H00084197-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for FLJ23356 Antibody (H00084197-M03)

Find related products by research area.

Blogs on FLJ23356

There are no specific blogs for FLJ23356, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ23356 Antibody (6F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK196
Entrez
Uniprot